Recombinant Archaeoglobus fulgidus  Uncharacterized protein AF_2191 (AF_2191)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2191 (AF_2191)

CSB-CF521496DOC
Regular price
€1.023,95 EUR
Sale price
€1.023,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Uniprot NO.:O28092

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYGRIFFNSGVQLLSMADKKFSLIALVSFTALAIIVLYHNISPYLTPSDLIAQGKAENV QVVGKIVSVNGNTFQLSDGKNTITAVYNGTVQRYDAEVVVVGNWDGKVLHATKVLQKCHT EYKGG

Protein Names:Recommended name: Uncharacterized protein AF_2191

Gene Names:Ordered Locus Names:AF_2191

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share