Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)

Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)

SKU:CSB-CF522360DOA

Regular price €1.389,95 EUR
Regular price Sale price €1.389,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O04616

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASSEETSSIDTNELITDLKEKWDGLENKSTVLIYGGGAIVAVWLSSIVVGAINSVPLLPK VMELVGLGYTGWFVYRYLLFKSSRKELAEDIESLKKKIAGSE

Protein Names:Recommended name: Uncharacterized protein At4g01150, chloroplastic

Gene Names:Ordered Locus Names:At4g01150 ORF Names:A_IG002N01.18, F2N1.18

Expression Region:63-164

Sequence Info:full length protein

View full details