Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01350 (AtMg01350)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01350 (AtMg01350)

SKU:CSB-CF310504DOA

Regular price €1.427,95 EUR
Regular price Sale price €1.427,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P92564

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTKREYNSQPEMKEEVLAYLLQLSASLVLPVAIWLIAAGQIFTCLRGYTISNYQEKVEEK LCSTLVDKISEKLADLFPVYGITPSRNAPFPTILEQLLATVSQEERLAYLSNMYNSLIEM GIDSPCFYPIVQTFLFLMGGGGGPA

Protein Names:Recommended name: Uncharacterized mitochondrial protein AtMg01350 Alternative name(s): ORF145c

Gene Names:Ordered Locus Names:AtMg01350

Expression Region:1-145

Sequence Info:full length protein

View full details