Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Translocator protein homolog(TSPO)

Recombinant Arabidopsis thaliana Translocator protein homolog(TSPO)

SKU:CSB-CF526860DOA

Regular price €1.483,95 EUR
Regular price Sale price €1.483,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O82245

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSQDIRYRGGDDRDAATTAMAETERKSADDNKGKRDQKRAMAKRGLKSLTVAVAAPVLV TLFATYFLGTSDGYGNRAKSSSWIPPLWLLHTTCLASSGLMGLAAWLVWVDGGFHKKPNA LYLYLAQFLLCLVWDPVTFRVGSGVAGLAVWLGQSAALFGCYKAFNEISPVAGNLVKPCL AWAAFVAAVNVKLAVA

Protein Names:Recommended name: Translocator protein homolog Short name= AtTSPO

Gene Names:Name:TSPO Ordered Locus Names:At2g47770 ORF Names:F17A22.16

Expression Region:1-196

Sequence Info:full length protein

View full details