Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Translocase of chloroplast 33, chloroplastic(TOC33)

Recombinant Arabidopsis thaliana Translocase of chloroplast 33, chloroplastic(TOC33)

SKU:CSB-CF521283DOA

Regular price €1.586,95 EUR
Regular price Sale price €1.586,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O23680

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGSLVREWVGFQQFPAATQEKLIEFFGKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIGEQ VVRVSPFQAEGLRPVMVSRTMGGFTINIIDTPGLVEAGYVNHQALELIKGFLVNRTIDVL LYVDRLDVYRVDELDKQVVIAITQTFGKEIWCKTLLVLTHAQFSPPDELSYETFSSKRSD SLLKTIRAGSKMRKQEFEDSAIAVVYAENSGRCSKNDKDEKALPNGEAWIPNLVKAITDV ATNQRKAIHVDKKMVDGSYSDDKGKKLIPLIIGAQYLIVKMIQGAIRNDIKTSGKPL

Protein Names:Recommended name: Translocase of chloroplast 33, chloroplastic Short name= AtToc33 EC= 3.6.5.- Alternative name(s): 33 kDa chloroplast outer envelope protein Plastid protein import 1

Gene Names:Name:TOC33 Synonyms:PPI1 Ordered Locus Names:At1g02280 ORF Names:T7I23.11

Expression Region:1-297

Sequence Info:full length protein

View full details