Gene Bio Systems
Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic(TMP14)
Recombinant Arabidopsis thaliana Thylakoid membrane phosphoprotein 14 kDa, chloroplastic(TMP14)
SKU:CSB-CF815834DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8LCA1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AAKATAYCRKIVRNVVTRATTEVGEAPATTTEAETTELPEIVKTAQEAWEKVDDKYAIGS LAFAGVVALWGSAGMISAIDRLPLVPGVLELVGIGYTGWFTYKNLVFKPDREALFEKVKS TYKDILGSS
Protein Names:Recommended name: Thylakoid membrane phosphoprotein 14 kDa, chloroplastic
Gene Names:Name:TMP14 Ordered Locus Names:At2g46820 ORF Names:F19D11.10
Expression Region:46-174
Sequence Info:full length protein
