Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 1(SCAMP1)

Recombinant Arabidopsis thaliana Secretory carrier-associated membrane protein 1(SCAMP1)

SKU:CSB-CF882895DOA

Regular price €1.572,95 EUR
Regular price Sale price €1.572,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SKT3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRYQSHSFDDGEINPFANPTSVPAATSKLSPLPPEPYDRGATMDIPLDSGKDLKAKEKE LREKEAELKRREQEIKRKEDAIAQAGIVIEEKNWPPFFPLIHHDISNEIPIHLQRIQYVA FTSMLGLVVCLLWNIVAVTTAWIKGEGPTIWFLAIIYFISGVPGAYVMWYRPLYRAMRTD SALKFGWFFFTYLFHIAFCVFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFYFIGFG FFCLESLVSIWVIQQVYMYFRGSGKAAEMKQEATRRAMMAAL

Protein Names:Recommended name: Secretory carrier-associated membrane protein 1 Short name= AtSC1 Short name= Secretory carrier membrane protein 1

Gene Names:Name:SCAMP1 Synonyms:SC1 Ordered Locus Names:At2g20840 ORF Names:F5H14.19

Expression Region:1-282

Sequence Info:full length protein

View full details