Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL73(ATL73)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL73(ATL73)

SKU:CSB-CF872275DOA

Regular price €1.443,95 EUR
Regular price Sale price €1.443,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FLC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TDANPRTLGDSVSNNKNIASMDTHMVIILAALLCALICALGINSVLRCVLRCTRRFTPNE DPVDTNANVAKGIKKRALKVIPVDSYSPELKMKATECLICLGDFVEGETVRVLPKCNHGF HVKCIDTWLLSHSSCPTCRQSLLEHQTPANGSRRGDDVAT

Protein Names:Recommended name: RING-H2 finger protein ATL73

Gene Names:Name:ATL73 Ordered Locus Names:At5g05280 ORF Names:K18I23.8

Expression Region:17-176

Sequence Info:full length protein

View full details