Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 9, chloroplastic(STR9)

Recombinant Arabidopsis thaliana Rhodanese-like domain-containing protein 9, chloroplastic(STR9)

SKU:CSB-CF527390DOA

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48529

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AEEAKQLIAEEGYSVVDVRDKTQFERAHIKSCSHIPLFIYNEDNDIGTIIKRTVHNNFSG LFFGLPFTKVNPEFLKSVRNEFSQDSKLLLVCQEGLRSAAAASRLEEAGYENIACVTSGL QSVKPGTFESVGSTELQNAGKAGLITIQGKISAVLGTVLVCAYLFIQFFPDQAEKLFPPT S

Protein Names:Recommended name: Rhodanese-like domain-containing protein 9, chloroplastic Alternative name(s): Sulfurtransferase 9 Short name= AtStr9

Gene Names:Name:STR9 Ordered Locus Names:At2g42220 ORF Names:T24P15.13

Expression Region:54-234

Sequence Info:full length protein

View full details