Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Reticulon-like protein B13(RTNLB13)

Recombinant Arabidopsis thaliana Reticulon-like protein B13(RTNLB13)

SKU:CSB-CF525366DOA

Regular price €1.488,95 EUR
Regular price Sale price €1.488,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O64837

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANDVTKDPTPKSDIVEDIYLWRRKKLAFSTLLVSTSTWILLSFYGFTTITIVSWIGIAV VSMIFLWGSLLRLLSKVEPELSGLEVSEEFVVETVRSCRMLMEEMVRWMFRVGAESEWFV FARTVLGFWILSRIGNLLDFHTCLFIGLVMGLTVPKLWEEYGDQIQKHLGSLKDKSKGAY NTTHEKILEMKNKLHHGTEEKVKKSE

Protein Names:Recommended name: Reticulon-like protein B13 Short name= AtRTNLB13

Gene Names:Name:RTNLB13 Ordered Locus Names:At2g23640 ORF Names:F26B6.29, F27L4.17

Expression Region:1-206

Sequence Info:full length protein

View full details