Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL69(ATL69)

Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL69(ATL69)

SKU:CSB-CF887795DOA

Regular price €1.442,95 EUR
Regular price Sale price €1.442,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FL42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPISPPASGVGLGYGIAIAVSILVLISFIMLASYICIRSKSTGRDEATSDVVLDLPSPA AEVKLGLDRPVIESYPRIVLGDSRRLPRPNNGPCSICLCDYEAREPVRCIPECNHCFHTD CVDEWLRTSATCPLCRNSPAPSRLATPLSDLVPLAFQIR

Protein Names:Recommended name: Putative RING-H2 finger protein ATL69

Gene Names:Name:ATL69 Ordered Locus Names:At5g07040 ORF Names:MOJ9.21

Expression Region:1-159

Sequence Info:full length protein

View full details