Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic(TIC20-V)

Recombinant Arabidopsis thaliana Protein TIC 20-v, chloroplastic(TIC20-V)

SKU:CSB-CF861846DOA

Regular price €1.444,95 EUR
Regular price Sale price €1.444,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FM67

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QSKGDDSVDASDRIISAVCYFYPFFDGIQYGKFIITQYQPFQILIQPLFPAIRAFKSFPF NGFLIFITLYFVVVRNPNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPRDGFGLDVVMS LDSTVFLFLLVSLIYGFSACLFGLTPRLPLVAEAADRQVL

Protein Names:Recommended name: Protein TIC 20-v, chloroplastic Alternative name(s): Translocon at the inner envelope membrane of chloroplasts 20-V Short name= AtTIC20-v

Gene Names:Name:TIC20-V Ordered Locus Names:At5g55710 ORF Names:MDF20.15

Expression Region:50-209

Sequence Info:full length protein

View full details