Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein SCO1 homolog 2, mitochondrial(HCC2)

Recombinant Arabidopsis thaliana Protein SCO1 homolog 2, mitochondrial(HCC2)

SKU:CSB-CF818512DOA

Regular price €1.552,95 EUR
Regular price Sale price €1.552,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8LAL0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AASFLRRCGPSKRIQSVNYCKSTRQGHEIPDVKPLFPTGGGTQAPSRSRARYAVPAILLG FAGFVGFLHYNDERRAVPRGQASSNSGCGCGSNTTVKGPIIGGPFTLVSTENKIVTENDF CGKWVLLYFGYSFSPDVGPEQLKMMSKAVDKLESKHNEKILPVFVTLDPQRDTPSHLHAY LKEFDSRILGLTGTASAMRQMAQEYRVYFKKVQEDGEDYLVDTSHNMYLINPKMEIVRCF GVEYNPDELSQELLKEVASVSQ

Protein Names:Recommended name: Protein SCO1 homolog 2, mitochondrial Alternative name(s): Homolog of the copper chaperone SCO1 member 2 Short name= HCC2

Gene Names:Name:HCC2 Synonyms:SCO1-2 Ordered Locus Names:At4g39740 ORF Names:T19P19.130

Expression Region:15-276

Sequence Info:full length protein

View full details