Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 6(PCR6)

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 6(PCR6)

SKU:CSB-CF864963DOA

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M9A5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGRPDQTPSPRMNNNFNPVFHAQSEQPVDEKRVLQAEQIYPNNGGVVNQPNQVPMRPGPP TYINQSATFNQPYGVSMAGPVHTQPSNWTSGLFDCMNDGENALITCCFPFVTFGQIAEVI DEGATSCGTAGMLYGLICCLFAIPCVYTCTFRTKLRSKYGLPDAPAPDWITHCFCEYCAL CQEYRELKNRGLDPSIGWIGNVQKQRMGQQQEMMAPPMGQRMMG

Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 6 Short name= AtPCR6

Gene Names:Name:PCR6 Ordered Locus Names:At1g49030 ORF Names:F27J15.18

Expression Region:1-224

Sequence Info:full length protein

View full details