Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 2(PCR2)

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 2(PCR2)

SKU:CSB-CF867992DOA

Regular price €1.438,95 EUR
Regular price Sale price €1.438,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LQU4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEAQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGA LYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKHRGY DMSLGWAGNVERQQNQGGVAMGAPVFQGGMTR

Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 2 Short name= AtPCR2

Gene Names:Name:PCR2 Ordered Locus Names:At1g14870 ORF Names:F10B6.27

Expression Region:1-152

Sequence Info:full length protein

View full details