Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein PAM68, chloroplastic(PAM68)

Recombinant Arabidopsis thaliana Protein PAM68, chloroplastic(PAM68)

SKU:CSB-CF528653DOA

Regular price €1.463,95 EUR
Regular price Sale price €1.463,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O49668

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DKTKSQVPKSITCINRLEISRIAPLHATMNSPKGFGPPPKKTKKSKKPKPGNQSDEDDDD EDEDDDDEEDERERGVIPEIVTNRMISRMGFTVGLPLFIGLLFFPFFYYLKVGLKVDVPT WVPFIVSFVFFGTALAGVSYGIVSSSWDPLREGSLLGWNEAKKNWPVFWQSFWNSSDKR

Protein Names:Recommended name: Protein PAM68, chloroplastic Alternative name(s): PHOTOSYNTHESIS AFFECTED MUTANT 68

Gene Names:Name:PAM68 Ordered Locus Names:At4g19100 ORF Names:T18B16.70

Expression Region:36-214

Sequence Info:full length protein

View full details