Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein disulfide-isomerase LQY1(LQY1)

Recombinant Arabidopsis thaliana Protein disulfide-isomerase LQY1(LQY1)

SKU:CSB-CF818102DOA

Regular price €1.383,95 EUR
Regular price Sale price €1.383,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GSJ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AELDPNTVVAISVGVASVALGIGIPVFYETQIDNAAKRENTQPCFPCNGTGAQKCRLCVG SGNVTVELGGGEKEVSNCINCDGAGSLTCTTCQGSGVQPRYLDRREFKDDD

Protein Names:Recommended name: Protein disulfide-isomerase LQY1 EC= 5.3.4.1 Alternative name(s): Protein LOW QUANTUM YIELD OF PHOTOSYSTEM II 1

Gene Names:Name:LQY1 Ordered Locus Names:At1g75690 ORF Names:F10A5.12, F10A5.4

Expression Region:44-154

Sequence Info:full length protein

View full details