Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable aquaporin NIP4-2(NIP4-2)

Recombinant Arabidopsis thaliana Probable aquaporin NIP4-2(NIP4-2)

SKU:CSB-CF855405DOA

Regular price €1.572,95 EUR
Regular price Sale price €1.572,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8W036

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSHGEEIEDEQISRIEKGNCKDSQGGMETAICSSPSIVCLTQKLIAEMIGTYFIIFSGC GVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAVFRRFPWYQV PLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTTPTDSSGQALVAEIIISFLLMFVISGVA TDSRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGRYKGIWVYIVGPFV GIFAGGFVYNFMRFTDKPLRELTKSASFLRSVAQKDNASKSDG

Protein Names:Recommended name: Probable aquaporin NIP4-2 Alternative name(s): NOD26-like intrinsic protein 4-2 Short name= AtNIP4;2 Nodulin-26-like major intrinsic protein 5 Short name= NodLikeMip5 Short name= Protein NLM5

Gene Names:Name:NIP4-2 Synonyms:NLM5 Ordered Locus Names:At5g37820 ORF Names:K22F20.60

Expression Region:1-283

Sequence Info:full length protein

View full details