Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein B2(PRA1B2)

Recombinant Arabidopsis thaliana PRA1 family protein B2(PRA1B2)

SKU:CSB-CF879756DOA

Regular price €1.501,95 EUR
Regular price Sale price €1.501,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SIY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSSPAILPVTNQQAATQSQPPINSHAFRTFLSRLSSSLRESLSQRRPWLELVDRSSFAR PDSLTDSFSRIRKNLAYFKVNYSAIVSLVLAFSLLSHPFSLLVLLSLLGSWMFLYLFRSS DQPLVLFGRSFSDRETLLGLVLTTIVVVFMTSVGSLLTSALTIGIAIVCLHGAFRVPDDL FLDEQEPANAGLLSFIGNSAATSAAASVVAGRV

Protein Names:Recommended name: PRA1 family protein B2 Short name= AtPRA1.B2

Gene Names:Name:PRA1B2 Ordered Locus Names:At2g40380 ORF Names:T3G21.15

Expression Region:1-213

Sequence Info:full length protein

View full details