Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit XI, chloroplastic(PSAL)

Recombinant Arabidopsis thaliana Photosystem I reaction center subunit XI, chloroplastic(PSAL)

SKU:CSB-CF890445DOA

Regular price €1.456,95 EUR
Regular price Sale price €1.456,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SUI4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AVKSDKTTFQVVQPINGDPFIGSLETPVTSSPLIAWYLSNLPGYRTAVNPLLRGVEVGLA HGFFLVGPFVKAGPLRNTAYAGSAGSLAAAGLVVILSMCLTIYGISSFKEGEPSIAPSLT LTGRKKQPDQLQTADGWAKFTGGFFFGGISGVTWAYFLLYVLDLPYFVK

Protein Names:Recommended name: Photosystem I reaction center subunit XI, chloroplastic Short name= PSI-L Alternative name(s): PSI subunit V

Gene Names:Name:PSAL Ordered Locus Names:At4g12800 ORF Names:T20K18.150

Expression Region:51-219

Sequence Info:full length protein

View full details