Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11D(PEX11D)

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11D(PEX11D)

SKU:CSB-CF526819DOA

Regular price €1.519,95 EUR
Regular price Sale price €1.519,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O80845

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGTTLDVSRAELALVVMYLNKAEARDKLCRAIQYGSKFLSGGQPGTAQNVDKSTSLARKV FRLFKFVNDLHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERA ELLGRISLFCWMGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQDEDYRAKLKKSNE RSLALIKSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKTP

Protein Names:Recommended name: Peroxisomal membrane protein 11D Alternative name(s): Peroxin-11D Short name= AtPEX11d

Gene Names:Name:PEX11D Ordered Locus Names:At2g45740 ORF Names:F4I18.28

Expression Region:1-236

Sequence Info:full length protein

View full details