Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Outward-rectifying potassium channel 4(KCO4)

Recombinant Arabidopsis thaliana Outward-rectifying potassium channel 4(KCO4)

SKU:CSB-CF863852DOA

Regular price €1.568,95 EUR
Regular price Sale price €1.568,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FWX6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEEENLLNENLLHPNESSPEETQVTTVSKSKWTILVLAMILLLVYLTFGVCTYSFFRDQF SGTETNLFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGVVFLDYLLNRVVSHV LSLQENAILDRINKTRNRAIRDHIAEDGKIRLKWKLCLAFCAVGLCVGSGALFLHVFERL DWLDSVYLSVISVTTVGYGDKTFKTVEGRGFAVFWLLLSTIAMATLFLYLAEMRIDRTTV MKLPPSESEFIVFKLRESGRISEDDIKQIVREFENLEEVPSSGS

Protein Names:Recommended name: Outward-rectifying potassium channel 4 Short name= AtKCO4 Alternative name(s): Two-pore potassium channel 4 Short name= AtTPK4

Gene Names:Name:KCO4 Synonyms:TPK4 Ordered Locus Names:At1g02510 ORF Names:T14P4.16

Expression Region:1-284

Sequence Info:full length protein

View full details