Gene Bio Systems
Recombinant Arabidopsis thaliana Oleosin 14.9 kDa(OL3)
Recombinant Arabidopsis thaliana Oleosin 14.9 kDa(OL3)
SKU:CSB-CF672618DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q43284
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ADQTRTHHEMISRDSTQEAHPKARQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPL LVIFSPVLVPAVVTVALIITGFLASGGFGIAAITAFSWLYRHMTGSGSDKIENARMKVGS RVQDTKYGQHNIGVQHQQVS
Protein Names:Recommended name: Oleosin 14.9 kDa
Gene Names:Name:OL3 Ordered Locus Names:At5g51210 ORF Names:MWD22.16
Expression Region:2-141
Sequence Info:full length protein
