Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Nudix hydrolase 11(NUDT11)

Recombinant Arabidopsis thaliana Nudix hydrolase 11(NUDT11)

SKU:CSB-CF822585DOA

Regular price €1.505,95 EUR
Regular price Sale price €1.505,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8LET2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSTTTDSTELQNLIKLFQNCQTHPRQHFPAKSSAVLVCLYQEQREDKNELRVILTKRST TLSSHPGEVALPGGKRDQEDKDDIATALREAREEIGLDPSLVTIISVLEPFVNKKGMSVA PVIGFLHDKKAFKQLPNPAEVEEIFDVPLEMFLKDRNRRAEEREHEGERYLLQYFDYYSE DKERSFIIWALTAGILIRVASIVYQRLPEFQERKPSFWNQPN

Protein Names:Recommended name: Nudix hydrolase 11 Short name= AtNUDT11 EC= 3.6.1.- Alternative name(s): Coenzyme A diphosphatase NUDT11

Gene Names:Name:NUDT11 Synonyms:NUDX11 Ordered Locus Names:At5g45940 ORF Names:K15I22.14

Expression Region:1-222

Sequence Info:full length protein

View full details