Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A(MEE4)

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A(MEE4)

SKU:CSB-CF819318DOA

Regular price €1.425,95 EUR
Regular price Sale price €1.425,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8RWA7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEAMIRNKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAMFLAVSGAFAWG MYQVGQGNKIRRALKEEKYAARRTILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV GENVYNSGRWMPPATGELRPDVW

Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A Alternative name(s): Protein MATERNAL EFFECT EMBRYO ARREST 4

Gene Names:Name:MEE4 Ordered Locus Names:At1g04630 ORF Names:T1G11.12

Expression Region:1-143

Sequence Info:full length protein

View full details