Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana HVA22-like protein d(HVA22D)

Recombinant Arabidopsis thaliana HVA22-like protein d(HVA22D)

SKU:CSB-CF865814DOA

Regular price €1.417,95 EUR
Regular price Sale price €1.417,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9S760

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKFWTFLTALHSGAGPIVMLLYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELIL QSLIEWIPIWYTVKLVFVAWLVLPQFQGAAFIYNRVVREQFKKHGVLRSTHSKPTKPNIL HSIFPHREGHEAHSH

Protein Names:Recommended name: HVA22-like protein d Short name= AtHVA22d

Gene Names:Name:HVA22D Ordered Locus Names:At4g24960 ORF Names:F13M23.100

Expression Region:1-135

Sequence Info:full length protein

View full details