Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA2(RMA2)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA2(RMA2)

SKU:CSB-CF308618DOA

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P93030

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIEKDEDDTTLVDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVD QYDHKREPPKCPVCKSDVSEATLVPIYGRGQKAPQSGSNVPSRPTGPVYDLRGVGQRLGE GESQRYMYRMPDPVMGVVCEMVYRRLFGESSSNMAPYRDMNVRSRRRAMQAEESLSRVYL FLLCFMFMCLFLF

Protein Names:Recommended name: E3 ubiquitin-protein ligase RMA2 EC= 6.3.2.- Alternative name(s): Protein RING membrane-anchor 2

Gene Names:Name:RMA2 Synonyms:A-RZF Ordered Locus Names:At4g28270 ORF Names:F26K10.15

Expression Region:1-193

Sequence Info:full length protein

View full details