Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL41(ATL41)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL41(ATL41)

SKU:CSB-CF874460DOA

Regular price €1.525,95 EUR
Regular price Sale price €1.525,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SLC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSNDRDHRRFNSDHHSFWPNPSTYDLNSKIMLAAVASLSGVILIVFALHLYARFVLRRR REAFRGLPVIFRHPFEMPKRGLNPTVIASLPTFTVGATDGVAASATECAVCLSVLKEQDK ARELPNCKHIFHVDCVDTWLTTCSTCPVCRTEVEPRPRLEPEPREGPVGTAPQLLVETRL NLTVEAASSSSSDNKTVVSPASRLNSFRKILTRERSSNRINHSCPDQDRVADLERH

Protein Names:Recommended name: E3 ubiquitin-protein ligase ATL41 EC= 6.3.2.- Alternative name(s): RING-H2 finger protein ATL41

Gene Names:Name:ATL41 Ordered Locus Names:At2g42360 ORF Names:MHK10.8

Expression Region:1-236

Sequence Info:full length protein

View full details