Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Copper transporter 6(COPT6)

Recombinant Arabidopsis thaliana Copper transporter 6(COPT6)

SKU:CSB-CF816752DOA

Regular price €1.427,95 EUR
Regular price Sale price €1.427,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GWP3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLL AVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGF AVGFMLFGSTAFKNPSDDEKPFEQL

Protein Names:Recommended name: Copper transporter 6 Short name= AtCOPT6

Gene Names:Name:COPT6 Ordered Locus Names:At2g26975

Expression Region:1-145

Sequence Info:full length protein

View full details