Gene Bio Systems
Recombinant Arabidopsis thaliana Copper transporter 1(COPT1)
Recombinant Arabidopsis thaliana Copper transporter 1(COPT1)
SKU:CSB-CF654393DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q39065
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWP GTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLV MLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCAC
Protein Names:Recommended name: Copper transporter 1 Short name= AtCOPT1
Gene Names:Name:COPT1 Ordered Locus Names:At5g59030 ORF Names:K18B18.10, K18B18.2
Expression Region:1-170
Sequence Info:full length protein
