Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chaperone protein dnaJ 72(ATJ72)

Recombinant Arabidopsis thaliana Chaperone protein dnaJ 72(ATJ72)

SKU:CSB-CF611865DOA

Regular price €1.467,95 EUR
Regular price Sale price €1.467,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q0WTI8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVDHYQVLGVTRNATKKEVKDAFRRLAIKYHPDKHAQSPEHVRHNATVRFKLVSEAYEVL NDDLKRASYNAGSDSDCFRRTSGSYSNPYGNRGGRAQGSGYGYGYGYSTRNRQASSFSSG FDSTFRYLTTRAFLLNLALAGGLYFAFTAIDTSGETLWKMRNSGKSFEEAMESIEKSKSH KDEG

Protein Names:Recommended name: Chaperone protein dnaJ 72 Short name= AtDjC72 Short name= AtJ72

Gene Names:Name:ATJ72 Synonyms:C72, LCR51 Ordered Locus Names:At2g41000 ORF Names:T3K9.23

Expression Region:1-184

Sequence Info:full length protein

View full details