Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana CASP-like protein At1g79780(At1g79780)

Recombinant Arabidopsis thaliana CASP-like protein At1g79780(At1g79780)

SKU:CSB-CF635948DOA

Regular price €1.474,95 EUR
Regular price Sale price €1.474,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q1PFB8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSNGEGGEVVAKRRRKGIKELVQVALRGGCLAASATAMAVMLTATEEGVADIYGFKLTL SSNWSFSPSYQYVVGACAGTVLYSLLQLCLGVYRLVTGSPITPSRFQAWLCFTSDQLFCY LMMSAGSAGSGVTNLNKTGIRHTPLPDFCKTLSSFCNHVALSLLLVFLSFIFLASSSFFT VLVLSTP

Protein Names:Recommended name: CASP-like protein At1g79780

Gene Names:Ordered Locus Names:At1g79780 ORF Names:F20B17.26

Expression Region:1-187

Sequence Info:full length protein

View full details