Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin TIP1-1(TIP1-1)

Recombinant Arabidopsis thaliana Aquaporin TIP1-1(TIP1-1)

SKU:CSB-CF328569DOA

Regular price €1.535,95 EUR
Regular price Sale price €1.535,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P25818

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPIRNIAIGRPDEATRPDALKAALAEFISTLIFVVAGSGSGMAFNKLTENGATTPSGLVA AAVAHAFGLFVAVSVGANISGGHVNPAVTFGAFIGGNITLLRGILYWIAQLLGSVVACLI LKFATGGLAVPAFGLSAGVGVLNAFVFEIVMTFGLVYTVYATAIDPKNGSLGTIAPIAIG FIVGANILAGGAFSGASMNPAVAFGPAVVSWTWTNHWVYWAGPLVGGGIAGLIYEVFFIN TTHEQLPTTDY

Protein Names:Recommended name: Aquaporin TIP1-1 Alternative name(s): Aquaporin TIP Gamma-tonoplast intrinsic protein Short name= Gamma-TIP Tonoplast intrinsic protein 1-1 Short name= AtTIP1;1 Tonoplast intrinsic protein, root-specific

Gene Names:Name:TIP1-1 Synonyms:AQP.1 Ordered Locus Names:At2g36830 ORF Names:T1J8.1

Expression Region:1-251

Sequence Info:full length protein

View full details