Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Aquaporin PIP2-3(PIP2-3)

Recombinant Arabidopsis thaliana Aquaporin PIP2-3(PIP2-3)

SKU:CSB-CF329986DOA

Regular price €1.572,95 EUR
Regular price Sale price €1.572,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P30302

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKDVEGPDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY KIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL IRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGTFVLV YTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKS KPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSLGSFRSAANV

Protein Names:Recommended name: Aquaporin PIP2-3 Alternative name(s): Plasma membrane intrinsic protein 2-3 Short name= AtPIP2;3 Plasma membrane intrinsic protein 2c Short name= PIP2c RD28-PIP TMP2C Water stress-induced tonoplast i

Gene Names:Name:PIP2-3 Synonyms:PIP2C, RD28 Ordered Locus Names:At2g37180 ORF Names:T2N18.6

Expression Region:1-285

Sequence Info:full length protein

View full details