Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Alternative oxidase 4, chloroplastic-chromoplastic(AOX4)

Recombinant Arabidopsis thaliana Alternative oxidase 4, chloroplastic-chromoplastic(AOX4)

SKU:CSB-CF687974DOA

Regular price €1.585,95 EUR
Regular price Sale price €1.585,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q56X52

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATILQDDEEKVVVEESFKAETSTGTEPLEEPNMSSSSTSAFETWIIKLEQGVNVFLTDSV IKILDTLYRDRTYARFFVLETIARVPYFAFMSVLHMYETFGWWRRADYLKVHFAESWNEM HHLLIMEELGGNSWWFDRFLAQHIATFYYFMTVFLYILSPRMAYHFSECVESHAYETYDK FLKASGEELKNMPAPDIAVKYYTGGDLYLFDEFQTSRTPNTRRPVIENLYDVFVNIRDDE AEHCKTMRACQTLGSLRSPHSILEDDDTEEESGCVVPEEAHCEGIVDCLKKSITS

Protein Names:Recommended name: Alternative oxidase 4, chloroplastic/chromoplastic EC= 1.-.-.- Alternative name(s): Plastid terminal oxidase Protein IMMUTANS

Gene Names:Name:AOX4 Synonyms:IM, PTOX Ordered Locus Names:At4g22260 ORF Names:T10I14_90

Expression Region:57-351

Sequence Info:full length protein

View full details