Gene Bio Systems
Recombinant Aquareovirus G Non-structural protein 5(S7)
Recombinant Aquareovirus G Non-structural protein 5(S7)
SKU:CSB-CF456130DNU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aquareovirus G (isolate American grass carp/USA/PB01-155/-) (AQRV-G)
Uniprot NO.:B2BNE5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPCQDTVSLSIQHTHVIIQNSCCTTVSTSASTSATAYGLGCLALGCAGIAAAGICICCLI HGCPACPRRLGVRKQSSLSKQGHVSFHHLNPSDRVSRPYHPSCPTDVDLYLGGVQHDPDY VSHAQPIETQPQPLPPPPAYS
Protein Names:Recommended name: Non-structural protein 5 Short name= NS5 Alternative name(s): NS16
Gene Names:Name:S7
Expression Region:1-141
Sequence Info:full length protein
