Gene Bio Systems
Recombinant Anemonia sulcata Delta-actitoxin-Avd1c
Recombinant Anemonia sulcata Delta-actitoxin-Avd1c
SKU:CSB-YP355673AKE
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Anemonia sulcata (Mediterranean snakelocks sea anemone)
Delivery time: 3-7 business days
Uniprot ID: P01528
AA Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-47aa
Protein length: Full Length
MW: 6.9 kDa
Alternative Name(s): ATX-II
Relevance: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM) (PubMed:15169781). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781).
Reference: "Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone."Hartung K., Rathmayer W.Pflugers Arch. 404:119-125(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.