Gene Bio Systems
Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9(A9)
Recombinant Alcelaphine herpesvirus 1 Putative apoptosis regulator A9(A9)
SKU:CSB-CF523612AZG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)
Uniprot NO.:O36423
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKMLGEPEFKENILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVISNS VEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWNDHLKKLKQIVKCH IVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAASCLTLLLLYFRTTQTK
Protein Names:Recommended name: Putative apoptosis regulator A9
Gene Names:Name:A9
Expression Region:1-168
Sequence Info:full length protein
