Gene Bio Systems
Recombinant Alcanivorax borkumensis UPF0060 membrane protein ABO_1373(ABO_1373)
Recombinant Alcanivorax borkumensis UPF0060 membrane protein ABO_1373(ABO_1373)
SKU:CSB-CF607198AAAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573)
Uniprot NO.:Q0VPS7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLALYTLGLFILTAVTEIVGCYLPYLWLKKSAPGWVLLPAAASLAMFAWLLSLHPTDAGR VYAAYGGVYVFVALLWLWGVEGVRPHPWDFVGVAVALAGMGIIMFAPRG
Protein Names:Recommended name: UPF0060 membrane protein ABO_1373
Gene Names:Ordered Locus Names:ABO_1373
Expression Region:1-109
Sequence Info:full length protein
