Skip to product information
1 of 1

Gene Bio Systems

Recombinant Alcanivorax borkumensis UPF0059 membrane protein ABO_2478(ABO_2478)

Recombinant Alcanivorax borkumensis UPF0059 membrane protein ABO_2478(ABO_2478)

SKU:CSB-CF604397AAAM

Regular price €1.462,95 EUR
Regular price Sale price €1.462,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573)

Uniprot NO.:Q0VLM2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPIALLLLAFAMSTDAFAAAIGKGAILKKPRLTEAFRIGIIFGSIEAITPLVGWLIGKS AASYVEAWDHWIAFSLLTVLGLHMIYEGTRPDGGSEEHKAQKMSLLRTCLTAFSTSIDAM AVGVSLAFINVNIWIASALIGLATTLMVTIGIMLGRAIGSVMGHRAEIFGGLTLIAVGAW ILYGQL

Protein Names:Recommended name: UPF0059 membrane protein ABO_2478

Gene Names:Ordered Locus Names:ABO_2478

Expression Region:1-186

Sequence Info:full length protein

View full details