Skip to product information
1 of 1

Gene Bio Systems

Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin

Recombinant Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin

SKU:CSB-EP307045AET

Regular price €999,95 EUR
Regular price Sale price €999,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P82981

Gene Names:N/A

Organism:Agkistrodon contortrix contortrix (Southern copperhead)

AA Sequence:VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP

Expression Region:1-234aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:32.4 kDa

Alternative Name(s):Fibrinogen-clotting enzyme (Snake venom serine protease) (SVSP) (Venombin B)

Relevance:Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1).

Reference:"A novel venombin B from Agkistrodon contortrix contortrix: evidence for recognition properties in the surface around the primary specificity pocket different from thrombin." Amiconi G., Amoresano A., Boumis G., Brancaccio A., De Cristofaro R., De Pascalis A., Di Girolamo S., Maras B., Scaloni A. Biochemistry 39:10294-10308(2000)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Thrombin-like snake venom serine protease that cleaves beta chain of fibrinogen (FGB), releasing fibrinopeptide B. Has a coagulant activity activating blood coagulation factors V (F5) and XIII (F13A1).

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Peptidase S1 family, Snake venom subfamily

Tissue Specificity:Expressed by the venom gland.

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details