Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aggregatibacter actinomycetemcomitans UPF0070 protein 1057(1057)

Recombinant Aggregatibacter actinomycetemcomitans UPF0070 protein 1057(1057)

SKU:CSB-CF524438AYK

Regular price €1.487,95 EUR
Regular price Sale price €1.487,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)

Uniprot NO.:O52728

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAYTIEEEQELTAIKAWWNENYKFIIVCFVIAFGGVFGWNYWQSHQIQKMHKASAEYEQA LFNYQKDPKAQAEQFNQFIKNNEKTSYAVLALLDKAKIAVENKDFPLAEDALKQAMAQSN DDILSSVSALRLASVQFQLGQLDPALESLKSVKEQAWNSAKNLLAGDIQLAKGDKETAKK SYQQAQENAGALEQQLIQVRLNNL

Protein Names:Recommended name: UPF0070 protein 1057

Gene Names:Name:1057

Expression Region:1-204

Sequence Info:full length protein

View full details