Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Protein E248R(Mal-140)

Recombinant African swine fever virus Protein E248R(Mal-140)

SKU:CSB-CF723830AYE

Regular price €1.518,95 EUR
Regular price Sale price €1.518,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)

Uniprot NO.:Q65244

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GGSTSKYSFKNTTNIISHSIFNQMQNCISMLDGKNYIGVFGDGNIINHVFQDLNLSLNTS CVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLKTTLIQN CVSALSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYT SKNFFDFIADAISAVFKNIMVAAVVIVLIIVGFIAVFYFLHSRTAMRRRKKLNRS

Protein Names:Recommended name: Protein E248R Short name= pE248R

Gene Names:Ordered Locus Names:Mal-140 ORF Names:k2R

Expression Region:2-236

Sequence Info:full length protein

View full details