Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Envelope protein p54 (War-136)

Recombinant African swine fever virus Envelope protein p54 (War-136)

SKU:CSB-CF316380AEI

Regular price €1.479,95 EUR
Regular price Sale price €1.479,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)

Uniprot NO.:P0CA00

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSEFFQPVYPRHYGECLSPVSTPSFFSTHMYTILIAIVVLVIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWVEVTPQPGTSKPAGATTASVGKPVTGRPATNRPVTDRPATN NPVTDRLVMATGGPAAASAAASAAASAAASAPAHPAEPYTTVTTQNTASQTMSAIENLRQ RSTYTHKDLENSL

Protein Names:Recommended name: Envelope protein p54

Gene Names:Ordered Locus Names:War-136

Expression Region:1-193

Sequence Info:full length protein

View full details