Gene Bio Systems
Recombinant Aeromonas hydrophila subsp. hydrophila UPF0060 membrane protein AHA_2410 (AHA_2410)
Recombinant Aeromonas hydrophila subsp. hydrophila UPF0060 membrane protein AHA_2410 (AHA_2410)
SKU:CSB-CF370291AUH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)
Uniprot NO.:A0KKX4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGELKTMGLFLVTALAEILGCYLPYLWLTQGRSVWLLLPAGLSLMLFAWLLSLHPTAAGR VYAAYGGVYIFVAILWLWLVDGIRPSLWDLVGSLVALCGMAIIMFAPREA
Protein Names:Recommended name: UPF0060 membrane protein AHA_2410
Gene Names:Ordered Locus Names:AHA_2410
Expression Region:1-110
Sequence Info:full length protein
