Skip to product information
1 of 1

Gene Bio Systems

Recombinant Adiantum capillus-veneris NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE)

Recombinant Adiantum capillus-veneris NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE)

SKU:CSB-CF774653AXO

Regular price €1.384,95 EUR
Regular price Sale price €1.384,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Adiantum capillus-veneris (Maidenhair fern)

Uniprot NO.:Q85FH3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFEQGLILSAYLLCVGFFGLITSRNMVRALMSLELIFNAITLNFITLSNLFDNRETGEIF TLFVIAVAAAEAATGLAIALSIHRNRRSTRIDQSNLLKW

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L

Gene Names:Name:ndhE

Expression Region:1-99

Sequence Info:full length protein

View full details