Skip to product information
1 of 1

Gene Bio Systems

Recombinant Actinidia deliciosa Fruit protein pKIWI502 (pKIWI502)

Recombinant Actinidia deliciosa Fruit protein pKIWI502 (pKIWI502)

SKU:CSB-EP337389AXF

Regular price €1.023,95 EUR
Regular price Sale price €1.023,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P43394

Gene Names: pKIWI502

Organism: Actinidia deliciosa (Kiwi)

AA Sequence: MSITLSRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGRLLSVASAILQDTAIRQDTYIWTPVPISRVLPAAAESLFKVIVDLSRSPDLVYNFVSPGQYVQIRIPEAIVNPPPRPAYFYIASPPSLVKKNLEFEFLIRSVPGTTSEVLCSLKEGDVVDLTQIIGRGFDIEQILPPEDYPTVLISVTGYGMSAGRSFIEEGFGANKRSDVRLYYGAENLETMGYQERFKDWEASGVRVIPVLSRPPPNWNGAVGYVQDVYLKDKPIADPRTTGAVLIGNPNMVEETRGILVAQGVSREKILVTQD

Expression Region: 1-317aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 51.2 kDa

Alternative Name(s):

Relevance:

Reference: Cloning and characterization of five cDNAs for genes differentially expressed during fruit development of kiwifruit (Actinidia deliciosa var. deliciosa).Ledger S.E., Gardner R.C.Plant Mol. Biol. 25:877-886(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details