Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acinetobacter baumannii UPF0060 membrane protein A1S_1909 (A1S_1909)

Recombinant Acinetobacter baumannii UPF0060 membrane protein A1S_1909 (A1S_1909)

SKU:CSB-CF385364AUD

Regular price €1.389,95 EUR
Regular price Sale price €1.389,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Uniprot NO.:A3M5Z2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFGLFIITAIAEILGCYFPYLILKEGKSAWLWLPTALSLAVFVWLLTLHPAASGRIYAAY GGIYIFTALMWLRFVDQVALTRWDILGGVIVLCGAGLIILQPQGLIR

Protein Names:Recommended name: UPF0060 membrane protein A1S_1909

Gene Names:Ordered Locus Names:A1S_1909

Expression Region:1-107

Sequence Info:full length protein

View full details