Skip to product information
1 of 1

Gene Bio Systems

Recombinant Acidovorax ebreus Probable intracellular septation protein A (Dtpsy_2029)

Recombinant Acidovorax ebreus Probable intracellular septation protein A (Dtpsy_2029)

SKU:CSB-CF496494AWK

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY))

Uniprot NO.:B9MAB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLIDFFPIILFFAAFKVWGIYVATAVAIAATVVQIGYIRLKHGKVEPLQWLSLGVIVL FGGATLLAHSETFIKWKPTVLYWLMGGTLLVGQLMFRKNFIQSLMGAQIDLPAPVWRNLN WGWTGFFATMGVLNLWVAYHFDTDTWVNFKLFGGIGLMFAFVIAQALYLSRHVKDEGDAA PKDLQP

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Dtpsy_2029

Expression Region:1-186

Sequence Info:full length protein

View full details