Recombinant Acidobacterium capsulatum  Protein CrcB homolog(crcB)

Recombinant Acidobacterium capsulatum Protein CrcB homolog(crcB)

CSB-CF506374AWJ
Regular price
€1.022,95 EUR
Sale price
€1.022,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670)

Uniprot NO.:C1F686

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYLWVALGGALGALARYTVGVWIYERLGTRFPYGTFAINVTGCFLIGLALTVLDAHMDL SPAWRLAIPTGFIGAYTTFSTFEYETLRAAQHGQMGTAVLYFGSSLALGILAVWLGMVVG NRIVA

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:ACP_3316

Expression Region:1-125

Sequence Info:full length protein

Your list is ready to share